PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10015819m
Common NameCICLE_v10015819mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 345aa    MW: 39316.1 Da    PI: 8.2616
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10015819mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.2e-3283136255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      prlrWt++LH +Fv+ave+LGG+e+AtPk++l+lm+vkgL+++hvkSHLQ+YR+
  Ciclev10015819m  83 PRLRWTQDLHLAFVHAVERLGGQERATPKSVLQLMNVKGLSIAHVKSHLQMYRS 136
                      8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-3079137IPR009057Homeodomain-like
PROSITE profilePS5129412.40579139IPR017930Myb domain
SuperFamilySSF466895.2E-1581137IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-2383138IPR006447Myb domain, plants
PfamPF002496.9E-984135IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MENVTDTVEI SSDDNKSNES GTQAFQKCSS FDLNEKAAMD DDENDNITNV PYNGGTSIIS  60
TNTTTEGKEI ITMARQYVRS KMPRLRWTQD LHLAFVHAVE RLGGQERATP KSVLQLMNVK  120
GLSIAHVKSH LQMYRSKKLD ASGQVLSNRT MQEGHDILEM YRKFNQHGRF RMDNRNYMSS  180
PLLKQPCDFK PYSSRYHPWA PVGHCTRYNP IIFQNEKKCF PYETIGNQGK CRNNSLSISW  240
DGSCISDQVQ YSKFQTASML EAQVLQGTEA GQHAQEMSSC KKLKRLKEND WSADLQLSLC  300
HNKDDNCVGM NNNNRQQSTK EIDTILSLSS WTSQLCKTQR FHQN*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006446804.10.0hypothetical protein CICLE_v10015819mg
TrEMBLV4W2900.0V4W290_9R
STRINGVIT_12s0028g02080.t012e-63(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-35G2-like family protein